PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG099800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 563aa    MW: 64132.7 Da    PI: 9.0395
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG099800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.64e-1061845541374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+av+++d +la++l++++++++spdgd +qRla+y++ +L+arla+ +s+ly++l +++ +    +e++++++l   ++P+
  Pavir.3KG099800.1.p 184 LRTLLIHCAQAVAADDRQLATELIKKIRQHSSPDGDCTQRLAFYLVDGLEARLAGIGSQLYRKLLAKRVT---DEEVFKIYNLCLSAFPL 270
                          6789***********************************************************9999888...7889999********** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          l+ s+  aN++I ea  g+++vHiiDf+i  G+QWp+L+q++a++ + pp+lR+Tg++  ++g    e  e+ g+rLa++A+ ++vpf++
  Pavir.3KG099800.1.p 271 LRSSYAFANKTIIEASRGQTKVHIIDFGICFGFQWPSLIQQFAEQ-GVPPMLRVTGIDVTRPGfgTLEIAEQAGKRLADYANMFKVPFQY 359
                          ********************************************6.889**********99989899999******************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +++r+e++++e+L+++++E +++n+ +++++l de+v+++s+rd+vLkl+++++Pkv+++v  + +++s+ F +rf e l +ys++f
  Pavir.3KG099800.1.p 360 QG-ISSRFENVQIEDLNIEEDEIVIINCLYRMKSLGDETVAMNSARDRVLKLMRRINPKVFILVVVNGSYSSPFFITRFKELLFHYSSVF 448
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d+++a++pr++e+r+ +E ++l+re+ n++ cegaer+er et+++W++r  +aGF+++p++  + +++  + + ++ + +  +e+sg+l
  Pavir.3KG099800.1.p 449 DMFDANVPRDNEARKLLEGRVLAREAINIIGCEGAERTERPETYKQWQARSLKAGFEQLPVDPAIFNSILEMKKAIYHEDFVADEDSGWL 538
                          *****************************************************************************999********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          ++gWk+r + ++S W+
  Pavir.3KG099800.1.p 539 LQGWKGRVMHAISKWK 554
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.985158534IPR005202Transcription factor GRAS
PfamPF035141.4E-103184554IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MSSHSMLHPL PAPLSPYNYG RSLFMPYQPS TSTGRAARFG FPALQIIRSA EDAKGFDKLV  60
IYLDSDKLSI CRLTTKAKVV EKSKCAVFQI TDHRVNNPYI QDLNTREERS SKQHTNTITC  120
EISQNRKFDR ILLCYRHECF NETLSLRELM AKQASKDSPK GQSKGHAQQR LRGKRQINKE  180
VVDLRTLLIH CAQAVAADDR QLATELIKKI RQHSSPDGDC TQRLAFYLVD GLEARLAGIG  240
SQLYRKLLAK RVTDEEVFKI YNLCLSAFPL LRSSYAFANK TIIEASRGQT KVHIIDFGIC  300
FGFQWPSLIQ QFAEQGVPPM LRVTGIDVTR PGFGTLEIAE QAGKRLADYA NMFKVPFQYQ  360
GISSRFENVQ IEDLNIEEDE IVIINCLYRM KSLGDETVAM NSARDRVLKL MRRINPKVFI  420
LVVVNGSYSS PFFITRFKEL LFHYSSVFDM FDANVPRDNE ARKLLEGRVL AREAINIIGC  480
EGAERTERPE TYKQWQARSL KAGFEQLPVD PAIFNSILEM KKAIYHEDFV ADEDSGWLLQ  540
GWKGRVMHAI SKWKPNESCS EQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-401885548375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963450.10.0PREDICTED: uncharacterized protein LOC101786830
SwissprotO809331e-145SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZCE30.0K3ZCE3_SETIT; Uncharacterized protein
STRINGSi024218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-147GRAS family protein